PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_096916DC5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 100aa    MW: 10944.4 Da    PI: 10.1041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_096916DC5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-072873651
                           HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                           + rr   N  A r++R++Kka ++ Lee+++ L a Nk+L+k+++ 
  Traes_7BL_096916DC5.1 28 KRRRPSGNQAAVRKYREKKKAHTALLEEEAARLRAMNKELAKKVQD 73
                           45666779*********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.00122390IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.6E-122691No hitNo description
PfamPF077163.0E-102772IPR004827Basic-leucine zipper domain
CDDcd146860.001582873No hitNo description
SuperFamilySSF579594.19E-63588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
KIAASASSDA GAETPAEFED AHVTSRSKRR RPSGNQAAVR KYREKKKAHT ALLEEEAARL  60
RAMNKELAKK VQDHAALEAE AARLHCLLVD VRGRIEGEIG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3547351e-110AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.13e-40PREDICTED: uncharacterized protein LOC100823660
SwissprotQ8VY765e-28BZP19_ARATH; Basic leucine zipper 19
TrEMBLW5HK862e-65W5HK86_WHEAT; Uncharacterized protein
STRINGBRADI1G30140.11e-39(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-12bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]